B. S. Wibowo,  SKM., MARS., CPHR. M. Apud Kusaeri,  S.Pd., M.Si. Moh. Rosiman,  S.Si. Moh. Rosiman,  S.Si. Bemby Yasyam,  S.Psi., M.Psi. - Moh. Rosiman,  S.Si. Bemby Yasyam,  S.Psi., M.Psi. Bemby Yasyam,  S.Psi., M.Psi. Agus Abdurrohman,  S.Ag. Agus Abdurrohman,  S.Ag. Sutoro,  S.T.

Capacity Building Training Biro KP Kementerian Pertanian

Biro Keuangan dan Perlengkapan Sekretariat Jenderal Kementerian Pertanian RI bekerjasama dengan Lembaga Manajemen Terapan TRUSTCO menyelenggarakan acara "Capacity Building Training". Acara ini dilaksanakan di Hotel Green Savana - Sentul City, Pada tanggal 8-9 Maret 2013.

Kegiatan Capacity Building Training dimulai dengan internalisasi dari pagi hingga malam, dan pada sore hari ada satu sessi dari Tim Trustco oleh pak M. Apud Kusaeri S.Pd, M.Si. Pada esok harinya kegiatan outdoor diawali dengan senam pagi sebagai pemanasan dan jogging, lalu sarapan di restauran, kemudian kegiatan outbound dilanjutkan diawali dengan simulasi ice breaking agar diantara peserta bisa saling berinteraksi dengan baik dan mencair, lalu diadakan penguatan team diteruskan pengujian team dengan simulasi, lalu diakhiri dengan penutup.

Untuk mendukung acara yang diikuti sekitar 160 orang ini, TRUSTCO menurunkan team yang terdiri dari Mas Rosiman, Pak Apud, Pak Agus, Mas Dedi, Mas Agus, Mas Subur, Mas Nedih, Mas Iwan dan Mas Supri.

Lihat Album Capacity Building Training Biro KP Kementerian Pertanian

Berita Terkait

9 Komentar

Apa Itu Domain ? Pengertian Nama Domain | 11 Oktober 2014 - 01:04:44 WIB
makasih telah memberikan informasi yang menarik ini. Sangat bermanfaat sekali. http: tiny.cc feedsolozine
cara menghilangkan varises | 24 Oktober 2014 - 15:44:17 WIB
kami memberikan informasi tentang cara menghilangkan varises dengan cepat http: goo.gl l23x0l | https: mysp.ac Smcb | http: caramenghilangkanvarisesdengancepat.wordpress.com | http: bit.ly 1qY7T8i | http: bit.ly 1pzr6bG | http: bit.ly 1qY7T8i | http: bit.ly 1pzr6bG |
khasiat ace maxs | 24 Oktober 2014 - 08:12:03 WIB
jumat berkah guys :) http: khasiattacemaxs.wordpress.com http: apotikonlineacepsuherman.o.net 2014 10 23 9-c ara-merangsang-suami-paling-hot http: o***payudarastadiumm4.wordpress.com http: goo.gl Adl5X1 https: mysp.ac SjsK http: o***jantungkoronerterampuh.com
cara menghilangkan varises | 31 Oktober 2014 - 14:30:25 WIB
kami memberikan informasi tentang cara menghilangkan varises dengan cepat http: goo.gl l23x0l | https: mysp.ac Smcb | http: caramenghilangkanvarisesdengancepat.wordpress.com | http: bit.ly 1tS6G4U | http: bit.ly 1DJTOiF | http: bit.ly 1FMzS0i | http: bit.ly 1z5RTF7 | |
cara menghilangkan jerawat secara alami | 31 Oktober 2014 - 08:10:06 WIB
kami memberikan informasi tentang cara menghilangkan jerawat secara alami http: goo.gl JwBIql | https: mysp.ac Smf7 | http: bit.ly 1qY7T8i | http: bit.ly 1pzr6bG | http: bit.ly 1qY7T8i | http: bit.ly 1pzr6bG |
cara mengobati gusi bengkak | 07 November 2014 - 10:48:03 WIB
terima kasih banyak informasinya , sangat bermanfaat http: goo.gl QjvreW |https: mysp.ac TbaT | http: caramengo***igusibengkak14.wordpress.com |
cara menghilangkan jerawat secara alami | 07 November 2014 - 08:33:48 WIB
kami memberikan informasi tentang cara menghilangkan jerawat secara alami http: goo.gl JwBIql | https: mysp.ac Smf7 | http: caramenghilangkanbekasjerawatsecaralami.wordpress.c om |
khasiat ace maxs | 12 November 2014 - 09:55:32 WIB
semngat2 https: mysp.ac TpXe http: goo.gl B69e5v http: khasiattacemaxs.wordpress.com
Khasiat ace maxs | 14 November 2014 - 13:00:27 WIB
makin memanas beritanya :) https: mysp.ac TpXe http: khasiattacemaxs.wordpress.com http: goo.gl B69e5v

Isi Komentar